Here is part of a script that causes the error:
File "/home/bcramer/workdir-aptaNET/feature_extraction.py", line 28, in <module>
apt=raw_input('GGGAGWAVIPV')
NameError: name 'raw_input' is not defined
# ##########################################
##pseAAC encoding
from sys import argv
import string
#20 native amino acids according to the alphabetical order of their single-letter codes
aa_20 = ['A','C','D','E','F','G','H','I','K','L','M','N','P','Q','R','S','T','V','W','Y']
#count_amino_acids
apt=raw_input('GGGAGWAVIPV')
target=raw_input("SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVY")
Below is the original code written by the script author:
#count_amino_acids
apt=raw_input('Please Enter Aptamer Sequence:')
target=raw_input("Please Enter Protein Sequence:")
CodePudding user response:
raw_input is a function that's available in Python 2. Python 3 renamed it to input. You should either amend your script accordingly, or use a Python version from the 2.x generation (probably the latest 2.7).
CodePudding user response:
Issue is that raw_input is input in Python 3.
apt=input('GGGAGWAVIPV')
target=input("SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVY")
